
Technical

Centre National De LA Recherche scientifique (France)

CeNTRO De REGULACIO GENOMICA (SPAIN)
Cdric Notredame

www.tcoffee.org

                                                                   T-Coffee:


                                                     Technical Documentation



                      T-Coffee Technical Documentation

                          (Version 5.70, June 2008)

                               www.tcoffee.org


                                  T-Coffee

                                  3D-Coffee

                                  M-Coffee

                                  R-Coffee

                               APDB and iRMSD

   ( Cdric Notredame, Centro de Regulacio Genomica, Centre National de la
                       Recherche Scientifique, France
License and Terms of Use    5
T-Coffee is distributed under the Gnu Public License    5
T-Coffee code can be re-used freely    5
T-Coffee can be incorporated in any pipeline: Plug-in/Plug-out.    5

Addresses and Contacts 6
Contributors     6
Addresses   6

Citations   8
T-Coffee    8
Mocca 9
CORE  10
Other Contributions    10
Bug Reports and Feedback    10

Installation     11
Standard Installation of T-Coffee 11
Installation of M-Coffee    12
Installation of APDB and iRMSD    13
Installation of seq_reformat      13
Installation of extract_from_pdb  13
Installation of 3D-Coffee   13

Quick Start 15
T-COFFEE    15
M-Coffee    15
iRMSD and APDB   16
MOCCA 16

Recent Modifications   17

Reference Manual 18
Environment Variables  18
   DIR_4_TCOFFEE 18
   TMP_4_TCOFFEE 18
   CACHE_4_TCOFFEE     18
   NO_ERROR_REPORT_4_TCOFFEE      18
   PDB_DIR  19
   NO_WARNING_4_TCOFFEE     19
Well Behaved Parameters     19
   Separation    19
   Posix    19
   Entering the right parameters  19
Parameters Syntax      20
   No Flag  20
   -parameters   20
   -t_coffee_defaults  20
   -special_mode 21
   -score [Deprecated] 21
   -evaluate     21
   -convert [cw] 21
   -do_align [cw]      22
Special Parameters     22
   -version 22
   -check_configuration     22
   -cache   22
   -update  22
   -full_log     22
   -other_pg     22
Input 23
   Sequence Input      23
   -infile [cw]  23
   -in (Cf -in from the Method and Library Input section)     23
   -get_type     23
   -type [cw]    23
   -seq     23
   -seq_source   23
   Structure Input     24
   -pdb     24
   Tree Input    24
   -usetree 24
   Structures, Sequences Methods and Library Input via the -in Flag      24
   -in      25
   Profile Input 26
   -profile 26
   -profile1 [cw]      26
   -profile2 [cw]      27
Alignment Computation  27
   Library Computation: Methods   27
   -lalign_n_top 27
   -align_pdb_param_file    27
   -align_pdb_hasch_mode    27
   Library Computation: Extension 27
   -lib_list [Unsupported]  27
   -do_normalise 27
   -extend  28
   -extend_mode  28
   -max_n_pair   28
   -seq_name_for_quadruplet 28
   -compact 28
   -clean   29
   -maximise     29
   -do_self 29
   -seq_name_for_quadruplet 29
   -weight  29
   Tree Computation    30
   -distance_matrix_mode    30
   -quicktree [CW]     30
   Pair-wise Alignment Computation      30
   -dp_mode 31
   -ktuple  31
   -ndiag   31
   -diag_mode    31
   -diag_threshold     32
   -sim_matrix   32
   -matrix [CW]  32
   -nomatch 32
   -gapopen 32
   -gapext  33
   -fgapopen     33
   -fgapext 33
   -cosmetic_penalty   33
   -tg_mode 33
   Weighting Schemes   33
   -seq_weight   33
   Multiple Alignment Computation 34
   -msa_mode     34
   -profile_comparison 34
   -profile_mode 34
   Alignment Post-Processing      34
   -clean_aln    34
   -clean_threshold    35
   -clean_iteration    35
   -clean_evaluation_mode   35
   -iterate 35
CPU Control 35
   Multithreading      35
   -multi_thread [NOT Supported]  35
   Limits   36
   -mem_mode     36
   -ulimit  36
   -maxlen  36
   Aligning more than 100 sequences with DPA 36
   -maxnseq 36
   -dpa_master_aln     36
   -dpa_maxnseq  36
   -dpa_min_score1     37
   -dpa_min_score2     37
   -dap_tree [NOT IMPLEMENTED]    37
Using Structures 37
   Generic  37
   -special_mode 37
   -check_pdb_status   37
   3D Coffee: Using SAP     38
   Using/finding PDB templates for the Sequences   38
   -template_file      38
   -struc_to_use 39
Multiple Local Alignments   40
   -domain/-mocca      40
   -start   40
   -len     40
   -scale   41
   -domain_interactive [Examples] 41
Output Control   42
   Generic  42
   Conventions Regarding Filenames      42
   Identifying the Output files automatically      42
   -no_warning   42
   Alignments    42
   -outfile 42
   -output  42
   -outseqweight 43
   -case    43
   -cpu     43
   -outseqweight 43
   -outorder [cw]      44
   -inorder [cw] 44
   -seqnos  44
   Libraries     44
   -out_lib 44
   -lib_only     44
   Trees    45
   -newtree 45
Reliability Estimation 45
   CORE Computation    45
   -evaluate_mode      45
Generic Output   46
   -run_name     46
   -quiet   46
   -align [CW]   46
APDB/iRMSD Parameters  46
   -quiet [Same as T-Coffee]      46
   -run_name [Same as T-Coffee]   46
   -aln     46
   -n_excluded_nb      47
   -maximum_distance   47
   -similarity_threshold    47
   -local_mode   47
   -filter  47
   -print_rapdb [Unsupported]     47
   -outfile [Same as T-Coffee]    48
   -color_mode   48

Building a Server      49
   Environment Variables    49
   Output of the .dnd file. 50
   Permissions   50
   Other Programs      50

Formats     51
Parameter files  51
Sequence Name Handling 51
Automatic Format Recognition      52
Structures  52
Sequences   52
Alignments  52
Libraries   53
   T-COFFEE_LIB_FORMAT_01   53
   T-COFFEE_LIB_FORMAT_02   53
Library List     54
Substitution matrices. 54
   ClustalW Style [Deprecated]    54
   BLAST Format [Recommended]     54
Sequences Weights      54

Known Problems   56

Technical Notes  57
Development 57
   Command Line List   57

To Do.      59
                          License and Terms of Use




T-Coffee is distributed under the Gnu Public License



       Please make sure you have  agreed  with  the  terms  of  the  license
       attached to the package before using  the  T-Coffee  package  or  its
       documentation. T-Coffee is a freeware open source distributed under a
       GPL license. This means that there is  no  restriction  to  its  use,
       either in an academic or a non academic environment.


T-Coffee code can be re-used freely

       Our philosophy is that code is meant to be re-used,  including  ours.
       No permission is needed, although we  are  always  happy  to  receive
       pieces of improved code.


T-Coffee can be incorporated in any pipeline: Plug-in/Plug-out.

       Our philosophy is to insure that as many methods as possible  can  be
       used as plug-ins within T-Coffee. Likewise,  we  will  give  as  much
       support as possible to anyone wishing to turn T-Coffee into a plug-in
       for another method. For more details on how to do this, see the plug-
       in and the plug-out sections of the Tutorial Manual.

       Again, you do not need our permission to either use T-Coffee (or your
       method as a plug-in/out) but if you let us know, we will  insure  the
       stability of T-Coffee within your system through future releases.




                           Addresses and Contacts


Contributors

T-coffee is  developed,  maintained,  monitored,  used  and  debugged  by  a
dedicated team that include:

      Cdric Notredame

      Fabrice Armougom

      Des Higgins

      Sebastien Moretti

      Orla O'Sullivan

      Eamon O'Toole

      Olivier Poirot

      Karsten Suhre

      Vladimir Keduas

      Iain Wallace

      Andreas Wilm


Addresses

       We are always very eager to get some user  feedback.  Please  do  not
       hesitate to drop  us  a  line   at:  cedric.notredame@europe.com  The
       latest updates of T-Coffee are always available  on:  www.tcoffee.org
       . On this address you will also find a link to some of the online  T-
       Coffee servers, including Tcoffee@igs



       T-Coffee can be used to automatically check if an updated version  is
       available, however the program will not update automatically, as this
       can cause endless reproducibility problems.

         PROMPT: t_coffee -update



                                  Citations

       It is important that you cite T-Coffee when you use it. Citing us  is
       (almost)  like  giving  us  money:  it  helps   us   convincing   our
       institutions that what we do is useful  and  that  they  should  keep
       paying our salaries and deliver Donuts to our offices  from  time  to
       time (Not that they ever did it, but it would be nice anyway).



       Cite the server if you used it, otherwise, cite  the  original  paper
       from 2000 (No, it was never named "T-Coffee 2000").

|Notredame C, Higgins DG, |Related Articles,          |
|Heringa J.               |[pic][pic]Links            |
|T-Coffee: A novel method for fast and accurate       |
|multiple sequence alignment.                         |
|J Mol Biol. 2000 Sep 8;302(1):205-17.                |
|PMID: 10964570 [PubMed - indexed for MEDLINE]        |


       Other useful publications include:


T-Coffee

|Claude JB, Suhre K,      |Related Articles,          |
|Notredame C, Claverie JM,|[pic][pic]Links            |
|Abergel C.               |                           |
|CaspR: a web server for automated molecular          |
|replacement using homology modelling.                |
|Nucleic Acids Res. 2004 Jul 1;32(Web Server          |
|issue):W606-9.                                       |
|PMID: 15215460 [PubMed - indexed for MEDLINE]        |


|Poirot O, Suhre K, Abergel |Related Articles,        |
|C, O'Toole E, Notredame C. |[pic]Links               |
|3DCoffee@igs: a web server for combining sequences   |
|and structures into a multiple sequence alignment.   |
|Nucleic Acids Res. 2004 Jul 1;32(Web Server          |
|issue):W37-40.                                       |
|PMID: 15215345 [PubMed - indexed for MEDLINE]        |


|O'Sullivan O, Suhre K,     |Related Articles,        |
|Abergel C, Higgins DG,     |[pic]Links               |
|Notredame C.               |                         |
|3DCoffee: combining protein sequences and structures |
|within multiple sequence alignments.                 |
|J Mol Biol. 2004 Jul 2;340(2):385-95.                |
|PMID: 15201059 [PubMed - indexed for MEDLINE]        |


|Poirot O, O'Toole E,       |Related Articles,        |
|Notredame C.               |[pic]Links               |
|Tcoffee@igs: A web server for computing, evaluating  |
|and combining multiple sequence alignments.          |
|Nucleic Acids Res. 2003 Jul 1;31(13):3503-6.         |
|PMID: 12824354 [PubMed - indexed for MEDLINE]        |


|Notredame C.               |Related Articles,        |
|                           |[pic]Links               |
|Mocca: semi-automatic method for domain hunting.     |
|Bioinformatics. 2001 Apr;17(4):373-4.                |
|PMID: 11301309 [PubMed - indexed for MEDLINE]        |


|Notredame C, Higgins DG,   |Related Articles,        |
|Heringa J.                 |[pic]Links               |
|T-Coffee: A novel method for fast and accurate       |
|multiple sequence alignment.                         |
|J Mol Biol. 2000 Sep 8;302(1):205-17.                |
|PMID: 10964570 [PubMed - indexed for MEDLINE]        |


|Notredame C, Holm L,       |Related Articles,        |
|Higgins DG.                |[pic]Links               |
|COFFEE: an objective function for multiple sequence  |
|alignments.                                          |
|Bioinformatics. 1998 Jun;14(5):407-22.               |
|PMID: 9682054 [PubMed - indexed for MEDLINE]         |



Mocca

|Notredame C.               |Related Articles,        |
|                           |[pic]Links               |
|Mocca: semi-automatic method for domain hunting.     |
|Bioinformatics. 2001 Apr;17(4):373-4.                |
|PMID: 11301309 [PubMed - indexed for MEDLINE]        |


CORE

       http://igs-server.cnrs-mrs.fr/~cnotred/Publications/Pdf/core.pp.pdf


Other Contributions

       We do not mean to steal code, but we will always try to  re-use  pre-
       existing code whenever that code exists, free of copyright, just like
       we expect people to do with our code. However, whenever this happens,
       we make a point  at  properly  citing  the  source  of  the  original
       contribution. If ever you recognize a piece of your  code  improperly
       cited, please drop us a note and we will be happy to correct that.

       In the mean time, here are some important pieces of code  from  other
       packages that have been incorporated  within  the  T-Coffee  package.
       These include:

            -The Sim algorithm of Huang and Miller that given two  sequences
       computes the N best scoring local alignments.

            -The tree reading/computing routines are taken from the ClustalW
       Package, courtesy of Julie Thompson,  Des  Higgins  and  Toby  Gibson
       (Thompson, Higgins, Gibson, 1994,  4673-4680,vol.  22,  Nucleic  Acid
       Research).

            -The implementation of the algorithm for aligning two  sequences
       in linear space was adapted from Myers and Miller, in  CABIOS,  1988,
       11-17, vol. 1)

             -Various  techniques  and  algorithms  have  been  implemented.
       Whenever relevant, the source of the code/algorithm/idea is indicated
       in the corresponding function.

             -64  Bits  compliance  was  implemented   by   Benjamin   Sohn,
       Performance Computing Center Stuttgart (HLRS), Germany

            -David Mathog (Caltech) provided many fixes and useful  feedback
       for improving the code  and  making  the  whole  soft  behaving  more
       rationnaly


Bug Reports and Feedback

            -Prof David Jones (UCL) reported and  corrected  the  PDB1K  bug
       (now t_coffee/sap can align PDB sequences longer than 1000 AA).

            -Johan Leckner reported several bugs related to the treatment of
       PDB structures, insuring a consistent behavior between  version  1.37
       and current ones.






                                Installation


Standard Installation of T-Coffee

       1-decompress distribution.tar.gz


         gunzip distribution.tar.gz

       2-untar distribution.tar


         tar -xvf distribution.tar

       3-This will create the  distribution  directory  with  the  following
       structure:


         distribution/bin


         distribution/doc/t_coffee_doc.pdf,t_coffee_doc.html


         distribution/t_coffee_source


         distribution/example


         distribution/html

       4-go into the main directory and type:


         ./install

       You will know the installation proceeded completely with the mention:


         Installation of t_coffee Successful

       5-When this is done, the t_coffee executable appears as:


         bin/t_coffee

       You can  copy  this  file  to  the  location  where  you  store  your
       executables (often something like (~/bin/).  Alternatively,  you  can
       also add the current location to your path  (Not  recommended)  using
       the following:


         set path = ($path . <address of the t_coffee bin folder>)


       Note: The latest t_coffee distribution  (2.15  and  higher)  is  self
       contained and only requires one executable.  You  may  still  require
       external modules (sap, blast, ClustalW) if you wish  to  use  another
       mode than the default.


       Note: When updating, make sure to remove the old distribution and any
       associated program from your path.

         6-If you have PDB installed:

       Assuming you have a standard PDB installation in your file system


         setenv (or export)  PDB_DIR <abs path>/data/structures/all/pdb/


         OR


         setenv (or export)  PDB_DIR <abs path>/structures/divided/pdb/

       If you do not bhave PDB installed, don't worry, t_coffee will go  and
       fetch any structure it needs directly from  the  PDB  repository.  It
       will simply be a bit slower than if you had PDB locally.


Installation of M-Coffee

       M-Coffee is a special mode of T-Coffee  that  makes  it  possible  to
       combine the output of many multiple sequence alignment  packages.  M-
       Coffee requires  a  standard  T-Coffee  installation  (c.f.  previous
       section) and the following packages to be installed on your system:




Package          Where From


==========================================================


ClustalW         can interact with t_coffee


----------------------------------------------------------


Poa              http://www.bioinformatics.ucla.edu/poa/


----------------------------------------------------------


Muscle           http://www.drive5.com


 ----------------------------------------------------------


ProbCons         http://probcons.stanford.edu/


----------------------------------------------------------





MAFFT http://www.biophys.kyoto-u.ac.jp/~katoh/programs/align/mafft/


----------------------------------------------------------


Dialign-T        http://dialign-t.gobics.de/


----------------------------------------------------------


PCMA             ftp://iole.swmed.edu/pub/PCMA/






       In our hands all these packages where very straightforward to compile
       and install on a standard cygwin or Linux  configuration.  Just  make
       sure you have gcc, the C compiler, properly installed.

       Once the package is compiled and ready to use,  make  sure  that  the
       executable  is  on  your  path,  so  that  t_coffee   can   find   it
       automatically. Our favorite procedure is to create a bin directory in
       the home. If you do so, make sure this bin is in your path  and  fill
       it with all your executables (this is a standard Unix practice).

       If you cannot, or do not want to use a single bin directory, you  can
       set the following environment variables to the absolute  path  values
       of the executable you want to  use.  Whenever  they  are  set,  these
       variables will supersede any other declaration. This is a  convenient
       way to experiment with multiple package versions.

           POA_4_TCOOFFEE

           CLUSTALW_4_TCOFFEE

           POA_4_TCOFFEE

           TCOFFEE_4_TCOFFEE

           MAFFT_4_TCOFFEE

           MUSCLE_4_TCOFFEE

           DIALIGNT_4_TCOFFEE
       For two of these packages, you will need to copy some of the files in
       a special T-Coffee directory.

            cp POA_DIR/* ~/.t_coffee/mcoffee/
            cp DIALIGN-T/conf/*  ~/.t_coffee/mcoffee
       Note that the following files are enough for default usage:

         BLOSUM.diag_prob_t10   BLOSUM75.scr  blosum80_trunc.mat
         dna_diag_prob_100_exp_330000  dna_diag_prob_200_exp_110000
         BLOSUM.scr             BLOSUM90.scr  dna_diag_prob_100_exp_110000
         dna_diag_prob_100_exp_550000  dna_diag_prob_250_exp_110000
         BLOSUM75.diag_prob_t2  blosum80.mat  dna_diag_prob_100_exp_220000
         dna_diag_prob_150_exp_110000  dna_matrix.scr


       If you  would  rather  have  the  mcoffee  directory  in  some  other
       location, set the  MCOFFEE_4_TCOFFEE  environement  variable  to  the
       propoer directory:

            setenv MCOFFEE_4_TCOFFEE <directory containing mcoffee files>

Installation of APDB and iRMSD

APDB and iRMSD are incorporated in T-Coffee.  Once  t_coffee  is  installed,
you can invoque these programs by typing:

            t_coffee -other_pg apdb

            t_coffee -other_pg irmsd

Installation of seq_reformat

Seq_reformat is a reformatting package that is part of t_coffee. To  use  it
(and see the available options), type:

            t_coffee -other_pg seq_reformat

Installation of extract_from_pdb

Extract_from_pdb is a PDB reformatting package that is part of t_coffee.  To
use it (and see the available options), type.

            t_coffee -other_pg apdb -h
Extract_from_pdb  requires  wget  in  order  to  automatically   fetch   PDB
structures.




Installation of 3D-Coffee

       In order to make the most out of T-Coffee, you will need  to  install
       the following packages:




Package          Function


===================================================


---------------------------------------------------


wget             3DCoffee


                 Automatic Downloading of Structures


                 Remote use of the Fugue server


---------------------------------------------------


sap              structure/structure comparisons


                 (obtain it from W. Taylor, NIMR-MRC).


---------------------------------------------------


Blast            www.ncbi.nih.nlm.gov


---------------------------------------------------


Fugue            protein to structure alignment program


                 http://www-cryst.bioc.cam.ac.uk/fugue/download.html

       Once  the  package  is  installed,  make  sure  make  sure  that  the
       executable  is  on  your  path,  so  that  t_coffee   can   find   it
       automatically.


1 Installing Fugue for T-Coffee

       Uses a standard fugue installation and install the follwing packages:

            joy, melody, fugueali, sstruc, hbond

       Copy some data into:

           cp fugue/classdef.dat  /data/fugue/SUBST/classdef.dat

       OR

           Setenv MELODY_CLASSDEF=<location>

           Setenv MELODY_SUBST=fugue/allmat.dat



       All the other configuration files must be in the right location.


Installation of R-Coffee

       R-Coffee only requires the package Vienna to be installed,  in  order
       to compute multiple sequence alignments. To make the best out of  it,
       you should also have all the packages required by M-Coffee




Package          Function


===================================================


---------------------------------------------------


consan           R-Coffee


                 Computes highly accurate pairwise Alignments


                 NOT COMPULSORY


                 selab.janelia.org/software/consan/


---------------------------------------------------


RNAplfold        Computes RNA secondary Structures


                 www.tbi.univie.ac.at/~ivo/RNA/


---------------------------------------------------


probconsRNA      probcons.stanford.edu/





---------------------------------------------------


M-Coffee         T-Coffee and the most common MSA Packages


                 (cf M-Coffee in this installation guide)


1 Installing ProbbonsRNA for R-Coffee

       Follow the installation procedure,  but  make  sure  you  rename  the
       probcons executable into probconsRNA.


2 Installing Consan for R-Coffee

       In order to insure a proper interface beween consan and R-Coffee, you
       must  make  sure  that  the  file  mix80.mod  is  in  the   directory
       ~/.t_coffee/mcoffee or in the mcoffee directory otherwise declared.



                                 Quick Start

We only give you the very basics here. Please  use  the  Tutorial  for  more
detailed information on how to use our tools.

IMPORTANT: All the files mentionned here (sampe_seq...) can be found in the
example directory of the distribution.

T-COFFEE

       Write your sequences in the same file (Swiss-prot, Fasta or Pir)  and
       type.

         PROMPT: t_coffee sample_seq1.fasta
       This will output two files:


         sample_seq1.aln: your Multiple Sequence Alignment


         sample_seq1.dnd: The Guide tree (newick Format)

IMPORTANT:
In theory nucleic acids should be automatically detected and the default
methods should be adapted appropriately. However, sometimes this may fail,
either because the sequences are too short or contain too many ambiguity
codes.
When this happens, you are advised to explicitly set the type of your
sequences
NOTE: the -special_mode=dna is not needed or supported anymore
         PROMPT: t_coffee sample_dnaseq1.fasta -type=dna

M-Coffee

       M-Coffee is a Meta version of T-Coffee  that  makes  it  possible  to
       combine the output of at least eight packages (Muscle, probcons, poa,
       dialignT, mafft, clustalw, PCMA and T-Coffee).

       If all these packages are already  installed  on  your  machine.  You
       must:



       1-set the following environement variables

            export POA_DIR=[absolute path of the POA installation dir]
            export DIALIGNT_DIR=[Absolute path of the DIALIGN-T/conf
       Once this is done, write your sequences in a file and run: same  file
       (Swiss-prot, Fasta or Pir) and type.

         PROMPT: t_coffee sample_seq1.fasta -special_mode mcoffee
       If the program  starts  complaining  one  package  or  the  other  is
       missing, this means you will have to go the hard way and install  all
       these packages yourself... Proceed to the M-Coffee section  for  more
       detailed instructions.


R-Coffee

       R-Coffee can be used to align RNA  sequences,  using  their  RNApfold
       predicted secondary structures. The  best  results  are  obtained  by
       using the consan pairwise method. If you have consan installed:

         PROMPT: t_coffee sample_rnaseq1.fasta -special_mode rcoffee_consan
       This will only work if your sequences are short enough (less than 200
       nucleotides). A good alternative is the rmcoffee mode that  will  run
       Muscle, Probcons4RNA and MAfft and then use the secondary  structures
       predicted by RNApfold.

         PROMPT: t_coffee sample_rnaseq1.fasta -special_mode mrcoffee


       If you want to decide yourself which methods should be combined by R-
       Coffee, run:

         PROMPT: t_coffee sample_rnaseq1.fasta -special_mode rcoffee -method
         lalign_id_pair slow_pair





iRMSD and APDB

       All you need is a file containing the alignment of sequences  with  a
       known structure. These sequences must be named according to their PDB
       ID, followed by the chain  index  (  1aabA  for  instance).  All  the
       sequences do not need to have a known structure,  but  at  least  two
       need to have it.

       Given the alignment:



       PROMPT: t_coffee -other_pg irmsd -aln 3d_sample4.aln



MOCCA

       Write your sequences in the same file (Swiss-prot, Fasta or Pir)  and
       type.

         PROMPT: t_coffee -other_pg mocca sample_seq1.fasta
       This command output one files (<your sequences>.mocca_lib) and starts
       an interactive menu.


                            Recent Modifications

       Warning: This log of recent modifications  is  not  as  thorough  and
       accurate as it should be.

       -4.30 and upward: the FAQ has moved into a new tutorial document

       -4.30 and upward: -in has will be  deprecated  and  replaced  by  the
       flags: -profile,-method,-aln,-seq,-pdb

       -4.02: -special_mode=dna is still available but not any  more  needed
       or supported. Use type=protein or dna if you need to force things

       -3.28: corrected a bug  that  prevents  short  sequences  from  being
       correctly aligned

       -Use of @ as a separator when specifying methods parameters

       -The most notable modifications have to do with the structure of  the
       input. From version 2.20, all files must be tagged to indicate  their
       nature (A: alignment, S: Sequence,  L:  Library.).  We  are  becoming
       stricter, but that's for your own good.

       Another important modification has to do with the  flag  -matrix:  it
       now controls the matrix being used for the computation


                              Reference Manual



       This reference manual gives a list of all the flags that can be  used
       to modify the behavior of T-Coffee. For  your  convenience,  we  have
       grouped them according to their nature. To display a list of all  the
       flags used in the version of T-Coffee you are using (along with their
       default value), type:

         PROMPT: t_coffee
       Or

         PROMPT: t_coffee -help
       Or

         PROMPT: t_coffee -help -in
       Or any other parameter


Environment Variables

It is  possible  to  modify  T-Coffee's  behavior  by  setting  any  of  the
following  environement  variables.  On   the   bash   shell,   use   export
VAR="value". On the cshell, use set $VAR="xxx"


1 DIR_4_TCOFFEE

       By default this variable is set to $HOME/.t_coffee. This is where  T-
       Coffee expects to find its cache, tmp dir and possibly any  temporary
       data stored by the program.


2 TMP_4_TCOFFEE

       By default this variable is set to $HOME/.t_coffee/tmp. This is where
       T-Coffee stores temporary files.


3 CACHE_4_TCOFFEE

       By default this variable is set  to  $HOME/.t_coffee/cache.  This  is
       where T-Coffee stores any data expensive to obtain:  pdb  files,  sap
       alignments....


4 NO_ERROR_REPORT_4_TCOFFEE

       By default this variable is no set. Set it if you  do  not  want  the
       program to generate a verbose error output file (useful for running a
       server).


5 PDB_DIR

       Indicate the location of your local PDB installation.


6 NO_WARNING_4_TCOFFEE

       Suppresses all the warnings.


Well Behaved Parameters


1 Separation

       You can use any kind of separator you want (i.e.  ,;  <space>=).  The
       syntax used in this document is meant to be consistent with  that  of
       ClustalW. However, in  order  to  take  advantage  of  the  automatic
       filename compleation provided by many shells, you can replace "=" and
       "," with a space.


2 Posix

       T-Coffee is not POSIX compliant.


3 Entering the right parameters

       There are  many  ways  to  enter  parameters  in  T-Coffee,  see  the
       -parameter flag in


                             Parameters Priority

In general you will not need to use these complicated parameters. Yet, if
you find yourself typing long command lines on a regular basis, it may be
worth reading this section.

One may easily feel confused with the various manners in which the
parameters can be passed to t_coffee. The reason for these many mechanisms
is that they allow several levels of intervention. For instance, you may
install t_coffee for all the users and decide that the defaults we provide
are not the proper ones. In this case, you will need to make your own
t_coffee_default file.

Later on, a user may find that he/she needs to keep re-using a specific set
of parameters, different from those in t_coffee_default, hence the
possibility to write an extra parameter file: parameters. In summary:

-parameters > prompt parameters > -t_coffee_defaults > -special_mode

This means that -parameters supersede all the others, while parameters
provided via -special mode are the weakest.





Parameters Syntax


    No Flag

       If no flag is used <your sequence> must be the  first  argument.  See
       format for further information.
         PROMPT: t_coffee sample_seq1.fasta

       Which is equivalent to
         PROMPT: t_coffee Ssample_seq1.fasta

       When you do so, sample_seq1 is used as a name prefix for  every  file
       the program outputs.

    -parameters
       Usage: -parameters=parameters_file
       Default: no parameters file

       Indicates a file containing extra parameters.  Parameters  read  this
       way behave as if they had been added on the right end of the  command
       line that they either  supersede(one  value  parameter)  or  complete
       (list of values). For instance, the following  file  (parameter.file)
       could be used

*******sample_param_file.param********


      -in=Ssample_seq1.fasta,Mfast_pair


      -output=msf_aln


**************************************


       Note: This  is  one  of  the  exceptions  (with  -infile)  where  the
       identifier tag (S,A,L,M.) can be omitted. Any dataset  provided  this
       way will be assumed to be a sequence (S). These exceptions have  been
       designed to keep the program compatible with ClustalW.


       Note: This parameter file can ONLY contain valid parameters. Comments
       are not allowed. Parameters passed this  way  will  be  checked  like
       normal parameters.


       Used with:
         PROMPT: t_coffee -parameters=sample_param_file.param

       Will cause t_coffee  to  apply  the  fast_pair  method  onto  to  the
       sequences contained in sample_seq.fasta. If you wish,  you  can  also
       pipe these arguments into t_coffee,  by  naming  the  parameter  file
       "stdin" (as a rule, any file named stdin is expected to  receive  its
       content via the stdin)

         cat sample_param_file.param  | t_coffee -parameters=stdin


    -t_coffee_defaults
       Usage: -t_coffee_defaults=<file_name>
       Default: not used.

       This flag tells the program to use some default  parameter  file  for
       t_coffee. The format of that file is the same as the  one  used  with
       -parameters. The file used is either:

            1. <file name> if a name has been specified

            2.  ~/.t_coffee_defaults if no file was specified

             3.   The   file   indicated   by   the   environment   variable
       TCOFFEE_DEFAULTS

    -special_mode
       Usage: -special_mode= hard coded mode
       Default: not used.

       It indicates that t_coffee will use some hard coded parameters. These
       include:

            quickaln: very fast approximate alignment

            dali: a mode used to combine dali pairwise alignments

            evaluate: defaults for evaluating an alignment

            3dcoffee: runs t_coffee with the 3dcoffee parameterization



       Other modes exist that are not yet fully supported

    -score [Deprecated]
       Usage: -score
       Default: not used

       Toggles on the evaluate mode  and  causes  t_coffee  to  evaluates  a
       precomputed alignment  provided  via  -infile=<alignment>.  The  flag
       -output   must   be   set   to   an    appropriate    format    (i.e.
       -output=score_ascii,  score_html  or  score_pdf).  A  better  default
       parameterization    is    obtained    when     using     the     flag
       -special_mode=evaluate.

    -evaluate
       Usage: -evaluate
       Default: not used

       Replaces -score. This flag toggles on the evaluate  mode  and  causes
       t_coffee  to  evaluates  a  pre-computed   alignment   provided   via
       -infile=<alignment>. The flag -output must be set to  an  appropriate
       format (i.e. -output=score_ascii, score_html or score_pdf).



       The main purpose of -evaluate is to let you control every  aspect  of
       the  evaluation.   Yet   it   is   advisable   to   use   pre-defined
       parameterization: special_mode=evaluate.
         PROMPT: t_coffee -infile=sample_aln1.aln -special_mode=evaluate
         PROMPT: t_coffee -infile=sample_seq1.aln -in  Lsample_lib1.tc_lib
         -special_mode=evaluate

    -convert [cw]
       Usage: -convert
       Default: turned off

       Toggles on the conversion mode and causes  T-Coffee  to  convert  the
       sequences, alignments,  libraries  or  structures  provided  via  the
       -infile and -in flags. The output format must be set via the  -output
       flag. This flag can also be used if you  simply  want  to  compute  a
       library (i.e. you have an alignment and you want to turn  it  into  a
       library).

       This flag is ClustalW compliant.

    -do_align [cw]
       Usage:  -do_align
       Default: turned on

Special Parameters


    -version
       Usage: -version
       Default: not used

       Returns the current version number

    -check_configuration
       Usage: -check_configuration
       Default: not used

       Checks your system to determine whether all the programs T-Coffee can
       interact with are installed.

    -cache
       Usage: -cache=<use, update, ignore, <filename>>
       Default: -cache=use

       By default, t_coffee stores in a  cache  directory,  the  results  of
       computationally expensive (structural alignment) or network intensive
       (BLAST search) operations.

    -update
       Usage: -update
       Default: turned off

       Causes a wget access that checks whether the t_coffee version you are
       using needs updating.

    -full_log
       Usage: -full_log=<filename>
       Default: turned off

       Causes t_coffee to output a full  log  file  that  contains  all  the
       input/output files.

    -other_pg
       Usage: -other_pg=<filename>
       Default: turned off

       Some rumours claim that Tetris is embedded within T-Coffee and  could
       be ran using some special set of commands.  We  wish  to  deny  these
       rumours, although we may admit that several interesting  reformatting
       programs are now embedded in t_coffee and  can  be  ran  through  the
       -other_pg flag.
         PROMPT: t_coffee -other_pg=seq_reformat
         PROMPT: t_coffee -other_pg=unpack_all
         PROMPT: t_coffee -other_pg=unpack_extract_from_pdb

Input


1 Sequence Input


    -infile [cw]

       To remain compatible with ClustalW, it is possible  to  indicate  the
       sequences with this flag
         PROMPT: t_coffee -infile=sample_seq1.fasta

       Note: Common multiple sequence alignments format constitute  a  valid
       input format.


       Note: T-Coffee  automatically  removes  the  gaps  before  doing  the
       alignment. This behaviour is different from that  of  ClustalW  where
       the gaps are kept.


    -in (Cf -in from the Method and Library Input section)

    -get_type
       Usage: -get_type
       Default: turned off

       Forces t_coffee to identify the sequences type (PROTEIN, DNA).

    -type [cw]
       Usage: -type=DNA  PROTEIN DNA_PROTEIN
       Default: -type=<automatically set>

       This flag sets the type of the sequences. If  omitted,  the  type  is
       guessed automatically. This flag is compatible with ClustalW.
Warning:  In case of low complexity or short sequences, it is recommended
to set the type manually.

    -seq
       Usage: -seq=[<P,S><name>,]
       Default: none
       -seq is now the  recommended  flag  to  provide  your  sequences.  It
       behaves mostly like the -in flag.


    -seq_source
       Usage: -seq_source=<ANY or  _LS or LS >
       Default: ANY.

       You may not want to combine all the provided sequences into a  single
       sequence list. You can do by specifying that you do not want to treat
       all the -in files as potential sequence sources.

       -seq_source=_LA indicates that neither sequences provided via  the  A
       (Alignment) flag or via the L (Library flag) should be added  to  the
       sequence list.

       -seq_source=S means that only sequences provided via the S  tag  will
       be considered. All the other sequences will be ignored.

       Note:  This flag is mostly designed for interactions between T-Coffee
       and T-CoffeeDPA (the large scale version of T-Coffee).


2 Structure Input


    -pdb
       Usage:  -pdb=<pdbid1>,<pdbid2>.[Max 200]
       Default: None

       Reads or fetch a pdb file. It is possible to specify a chain or  even
       a sub-chain:

         PDBID(PDB_CHAIN)[opt] (FIRST,LAST)[opt]


       It is also possible to input structures via the  -in  flag.  In  that
       case, you will need to use the TAG identifier:

         -in Ppdb1 Ppdb2.


3 Tree Input


    -usetree
       Usage: -usetree=<tree file>
       Default: No file specified
       Format: newick tree format (ClustalW Style)

       This flag indicates that rather  than  computing  a  new  dendrogram,
       t_coffee must use a pre-computed one. The tree files are  in  phylips
       format and compatible with ClustalW. In  most  cases,  using  a  pre-
       computed tree will halve the computation time required  by  t_coffee.
       It is also possible to use trees output by ClustalW, Phylips and  any
       other program.

4 Structures, Sequences Methods and Library Input via the -in Flag

                    The -in Flag and its Identifier TAGS

<-in> is the real grinder of T-Coffee. Sequences, methods and alignments
all pass through so that T-Coffee can turn it all into a single list of
constraints (the library). Everything is done automatically with T-Coffee
going through each file to extract the sequences it contains. The methods
are then applied to the sequences. Pre-compiled constraint list can also be
provided. Each file provided via this flag must be preceded with a symbol
(Identifier TAG) that indicates its nature to T-Coffee. The TAGs currently
supported are the following:

P     PDB structure
S     for sequences (use it as well to treat an MSA as unaligned sequences)

M     Methods used to build the library
L     Pre-computed T-Coffee library
A     Multiple Alignments that must be turned into a Library

X     Substitution matrices.
R           Profiles. This is a legal multiple alignments that will be
      treated as single sequences (the sequences it contains will not be
      realigned).

If you do not want to use the TAGS, you will need to use the following
      flags in replacement of -in. Do not use the TAGS when using these
      flags:

-aln             Alignments       (A)
-profile    Profiles   (R)
-method     Method     (M)
-seq             Sequences  (S)
-lib             Libraries  (L)

    -in
       Usage: -in=[<P,S,A,L,M,X><name>,]
       Default: -in=Mlalign_id_pair,Mclustalw_pair
Note: -in can be replaced with the combined usage of -aln, iprofile, .pdb,
.lib, -method.

       See the box for  an  explanation  of  the  -in  flag.  The  following
       argument passed via -in


         PROMPT: t_coffee
         -in=Ssample_seq1.fasta,Asample_aln1.aln,Asample_aln2.msf,Mlalign_id_
         pair,Lsample_lib1.tc_lib -outfile=outaln



       This command will trigger the following chain of events:



       1-Gather all the sequences

       Sequences within all the provided files are pooled  together.  Format
       recognition is automatic. Duplicates are removed (if  they  have  the
       same name). Duplicates in a single file are only tolerated  in  FASTA
       format file, although they will cause sequences to be renamed.

       In the above case, the  total  set  of  sequences  will  be  made  of
       sequences contained in sequences1.seq, alignment1.aln, alignment2.msf
       and library.lib, plus the sequences initially gathered  by -infile.

       2-Turn alignments into libraries

       alignment1.aln and  alignment2.msf  will  be  read  and  turned  into
       libraries. Another library will be produced by  applying  the  method
       lalign_id_pair to the set of sequences previously obtained  (1).  The
       final library used for the alignment will be the combination  of  all
       this information.

       Note as well the following rules:



       1-Order: The  order  in  which  sequences,  methods,  alignments  and
       libraries are fed in is irrelevant.

       2-Heterogeneity: There is no need for  each  element  (A,  S,  L)  to
       contain the same sequences.

       3-No Duplicate: Each file  should  contain  only  one  copy  of  each
       sequence. Duplicates are only allowed in FASTA files but  will  cause
       the sequences to be renamed.

       4-Reconciliation: If two files (for instance two alignments)  contain
       different versions of the same  sequence  due  to  an  indel,  a  new
       sequence will be reconstructed and used instead:

         aln 1:hgab1   AAAAABAAAAA


         aln 2:hgab1   AAAAAAAAAACCC


       will cause the program to reconstruct and use the following sequence

         hgab1   AAAAABAAAAACCC


       This can be useful if you are  trying  to  combine  several  runs  of
       blast,  or  structural  information  where  residues  may  have  been
       deleted. However substitutions are forbidden. If two  sequences  with
       the same name cannot be merged, they will cause the program  to  exit
       with an information message.

       5-Methods: The method describer can either be built in (See ### for a
       list of all the available methods) or be a file describing the method
       to be used. The exact syntax is provided in part 4 of this manual.

       6-Substitution Matrices: If the method is a substitution  matrix  (X)
       then no other type of information should be provided. For instance:
         PROMPT: t_coffee sample_seq1.fasta -in=Xpam250mt  -gapopen=-10
         -gapext=-1

       This command results in a progressive alignment carried  out  on  the
       sequences in seqfile. The procedure does not  use  any  more  the  T-
       Coffee concistency  based  algorithm,  but  switches  to  a  standard
       progressive alignment algorithm (like ClustalW or Pileup)  much  less
       accurate. In  this  context,  appropriate  gap  penalties  should  be
       provided. The matrices are in  the  file  source/matrices.h.  Add-Hoc
       matrices can also be provided by the user (see  the  matrices  format
       section at the end of this manual).
Warning: Xmatrix does not have the same effect as using the -matrix flag.
The -matrix defines the matrix that will be used while compiling the
library while the Xmatrix defines the matrix used when assembling the final
alignment.

5 Profile Input


    -profile
       Usage: -profile=[<name>,] maximum of 200 profiles.
       Default: no default

       This flag causes T-Coffee to treat multiple alignments  as  a  single
       sequences,  thus  making  it  possible  to  make   multiple   profile
       alignments.  The   profile-profile   alignment   is   controlled   by
       -profile_mode and -profile_comparison. When  provided  with  the  -in
       flag, profiles must be preceded with the letter R.
         PROMPT: t_coffee -profile sample_aln1.aln,sample_aln2.aln
         -outfile=profile_aln
         PROMPT: t_coffee -in
         Rsample_aln1.aln,Rsample_aln2.aln,Mslow_pair,Mlalign_id_pair
         -outfile=profile_aln

       Note that when using -template_file, the program will also  look  for
       the templates associated with the profiles, even if the profiles have
       been provided as templates themselves (however it will not  look  for
       the template of the profile templates of the profile templates.)

    -profile1 [cw]
       Usage: -profile1=[<name>], one name only
       Default: no default

       Similar to the previous one and was provided for  compatibility  with
       ClustalW.

    -profile2 [cw]
       Usage: -profile1=[<name>], one name only
       Default: no default

       Similar to the previous one and was provided for  compatibility  with
       ClustalW.

Alignment Computation


1 Library Computation: Methods


    -lalign_n_top
       Usage: -lalign_n_top=<Integer>
       Default: -lalign_n_top=10

       Number of alignment reported by the local method (lalign).

    -align_pdb_param_file

       Unsuported

    -align_pdb_hasch_mode

       Unsuported

2 Library Computation: Extension


    -lib_list [Unsupported]
       Usage:  -lib_list=<filename>
       Default:unset

       Use this flag if you do not want the library computation to take into
       account all the possible pairs in your dataset. For instance

       Format:

      2 Name1 name2


      2 Name1 name4


      3 Name1 Name2 Name3.


            (the line 3 would be used by a multiple alignment method).

    -do_normalise
       Usage:  -do_normalise=<0 or a positive value>
       Default:-do_normalise=1000
       Development Only

       When using a value different from 0, this flag sets the score of  the
       highest scoring pair to 1000.

    -extend
       Usage:  -extend=<0,1 or a positive value>
       Default:-extend=1
       Development Only

       When turned on, this flag indicates that the library extension should
       be carried out when performing the multiple alignment. If -extend =0,
       the extension is not made, if it is set to 1, the extension  is  made
       on all the pairs in the library. If the extension is set  to  another
       positive value, the extension is only carried out on pairs  having  a
       weight value superior to the specified limit.

    -extend_mode
       Usage:  -extend=<string>
       Default:-extend=very_fast_triplet
       Warning: Development Only

       Controls the algorithm for matrix extension. Available modes include:

       relative_triplet           Unsupported

       g_coffee              Unsupported

       g_coffee_quadruplets  Unsupported

       fast_triplet          Fast triplet extension

       very_fast_triplet          slow triplet  extension,  limited  to  the
       -max_n_pair best sequence pairs when aligning two profiles

       slow_triplet          Exhaustive use of all the triplets

       mixt            Unsupported

       quadruplet            Unsupported

       test            Unsupported

       matrix                Use of the matrix -matrix

       fast_matrix           Use of the matrix -matrix. Profiles are  turned
       into consensus

    -max_n_pair
       Usage:  -max_n_pair=<integer>
       Default:-extend=10
       Development Only

       Controls    the    number    of    pairs    considered     by     the
       -extend_mode=very_fast_triplet. Setting it to 0 forces all the  pairs
       to be considered (equivalent to -extend_mode=slow_triplet).

    -seq_name_for_quadruplet
       Usage:  Unsupported

    -compact
       Usage:  Unsupported

    -clean
       Usage:  Unsupported

    -maximise
       Usage:  Unsupported

    -do_self
       Usage:  Flag -do_self
       Default: No

       This flag causes the extension to carried out  within  the  sequences
       (as opposed to between sequences). This is necessary when looking for
       internal repeats with Mocca.

    -seq_name_for_quadruplet
       Usage:  Unsupported

    -weight
       Usage:  -weight=<winsimN, sim or sim_<matrix_name or matrix_file> or
       <integer value>
       Default: -weight=sim

       Weight defines the way alignments are weighted  when  turned  into  a
       library.  Overweighting can be obtained with the OW<X> weight mode.



       winsimN indicates that the weight assigned to a given  pair  will  be
       equal to the percent identity within a window of 2N+1 length centered
       on that pair. For instance winsim10 defines a window of  10  residues
       around the pair being considered. This gives its own weight  to  each
       residue in the output library. In our hands, this type  of  weighting
       scheme has not provided any significant improvement over the standard
       sim value.
         PROMPT: t_coffee sample_seq1.fasta -weight=winsim10
         -out_lib=test.tc_lib

       sim indicates that the weight equals the average identity within  the
       sequences containing the matched residues.

       OW<X> Will cause the sim weight to be multiplied by X

       sim_matrix_name indicates the  average  identity  with  two  residues
       regarded as identical when their substitution value is positive.  The
       valid matrices names are in matrices.h (pam250mt) .Matrices not found
       in this header are considered to be filenames. See the format section
       for matrices. For instance, -weight=sim_pam250mt indicates  that  the
       grouping used for similarity will be the set of classes with positive
       substitutions.
         PROMPT: t_coffee sample_seq1.fasta -weight=winsim10
         -out_lib=test.tc_lib

       Other groups include

       sim_clustalw_col ( categories of clustalw marked with :)

       sim_clustalw_dot ( categories of clustalw marked with .)

       Value indicates that all the pairs found in the  alignments  must  be
       given the same weight  equal  to  value.  This  is  useful  when  the
       alignment one wishes to turn into a library  must  be  given  a  pre-
       specified score (for instance if they come from  a  structure  super-
       imposition program). Value is an integer:
         PROMPT: t_coffee sample_seq1.fasta -weight=1000
         -out_lib=test.tc_lib

3 Tree Computation


    -distance_matrix_mode
       Usage: -distance_matrix_mode=<slow, fast, very_fast>
       Default: very_fast

       This flag indicates the method used for computing the distance matrix
       (distance  between  every  pair  of  sequences)  required   for   the
       computation of the dendrogram.

       Slow      The chosen dp_mode using the extended library,

       fast:     The fasta dp_mode using the extended library.

       very_fast The fasta dp_mode using blosum62mt.

       ktup Ktup matching (Muscle kind)

       aln       Read the distances on a precomputed MSA

    -quicktree [CW]
       Usage: -quicktree
       Description: Causes T-Coffee to compute a fast approximate guide tree
       This flag is kept for compatibility with ClustalW. It indicates that:

         PROMPT: t_coffee sample_seq1.fasta -distance_matrix_mode=very_fast
         PROMPT: t_coffee sample_seq1.fasta -quicktree

4 Pair-wise Alignment Computation


                      Controlling Alignment Computation

Most parameters in this section refer to the alignment mode fasta_pair_wise
and cfatsa_pair_wise. When using these alignment modes, things proceed as
follow:
1-Sequences are recoded using a degenerated alphabet provided with <-
sim_matrix>
2-Recoded sequences are then hashed into ktuples of size <-ktup>
3-Dynamic programming runs on the <-ndiag> best diagonals whose score is
higher than <-diag_threshold>, the way diagonals are scored is controlled
via <-diag_mode> .
4-The Dynamic computation is made to optimize either the library scoring
scheme (as defined by the -in flag) or a substitution matrix as provided
via the -matrix flag. The penalty scheme is defined by -gapopen and
-gapext. If -gapopen is undefined, the value defined in -cosmetic_penalty
is used instead.
5-Terminal gaps are scored according to -tg_mode




    -dp_mode
       Usage:  -dp_mode=<string>
       Default: -dp_mode=cfasta_fair_wise

       This flag indicates the type  of  dynamic  programming  used  by  the
       program:
         PROMPT: t_coffee sample_seq1.fasta -dp_mode myers_miller_pair_wise

       gotoh_pair_wise: implementation of the gotoh algorithm (quadratic  in
       memory and time)

       myers_miller_pair_wise:  implementation  of  the  Myers  and   Miller
       dynamic programming algorithm (  quadratic  in  time  and  linear  in
       space). This algorithm is recommended for very long sequences. It  is
       about 2 times slower than gotoh and only accepts tg_mode=1or 2  (i.e.
       gaps penalized for opening).

       fasta_pair_wise: implementation of the fasta algorithm. The  sequence
       is hashed, looking for ktuples words.  Dynamic  programming  is  only
       carried out on the ndiag best scoring diagonals. This is much  faster
       but less accurate than the two previous. This mode is  controlled  by
       the parameters -ktuple, -diag_mode and -ndiag

       cfasta_pair_wise: c stands for checked. It is the same algorithm. The
       dynamic programming is made on the ndiag best diagonals, and then  on
       the 2*ndiags, and so on until the scores  converge.  Complexity  will
       depend on the level of divergence of the sequences, but will  usually
       be L*log(L), with an accuracy comparable to the two first mode ( this
       was checked on BaliBase). This mode is controlled by  the  parameters
       -ktuple, -diag_mode and -ndiag

       Note: Users may find by looking into the code that other  modes  with
       fancy names exists  (viterby_pair_wise.)  Unless  mentioned  in  this
       documentation, these modes are not supported.


    -ktuple
       Usage:  -ktuple=<value>
       Default: -ktuple=1 or 2

       Indicates  the  ktuple  size   for   cfasta_pair_wise   dp_mode   and
       fasta_pair_wise. It is set to 1 for proteins,  and  2  for  DNA.  The
       alphabet used for protein can be  a  degenerated  version,  set  with
       -sim_matrix..

    -ndiag
       Usage:  -ndiag=<value>
       Default: -ndiag=0

       Indicates  the  number  of  diagonals  used  by  the  fasta_pair_wise
       algorithm (cf -dp_mode). When  -ndiag=0, n_diag=Log  (length  of  the
       smallest sequence)+1.

       When -ndiag and -diag_threshold are set, diagonals  are  selected  if
       and only if they fulfill both conditions.


    -diag_mode
       Usage:  -diag_mode=<value>
       Default: -diag_mode=0

       Indicates the manner in which diagonals are scored during  the  fasta
       hashing.

       0: indicates that the score of a diagonal is equal to the sum of  the
       scores of the exact matches it contains.

       1 indicates that this score is set equal to the  score  of  the  best
       uninterrupted  segment  (useful  when  dealing  with   fragments   of
       sequences).

    -diag_threshold
       Usage:  -diag_threshold=<value>
       Default: -diag_threshold=0

       Sets the value of the threshold when selecting diagonals.

       0: indicates that -ndiag should be used to select the  diagonals  (cf
       -ndiag section).

    -sim_matrix
       Usage:  -sim_matrix=<string>
       Default: -sim_matrix=vasiliky

       Indicates the manner in which the amino acid alphabet is  degenerated
       when hashing in  the  fasta_pairwise  dynamic  programming.  Standard
       ClustalW matrices are all valid. They are used to  define  groups  of
       amino acids having positive substitution  values.  In  T-Coffee,  the
       default is a 13 letter grouping named Vasiliky, with residues grouped
       as follows:

         rk, de, qh, vilm, fy (other residues kept alone).


       This alphabet is set with the flag -sim_matrix=vasiliky. In order  to
       keep the alphabet non degenerated, -sim_matrix=idmat can be  used  to
       retain the standard alphabet.

    -matrix [CW]
       Usage:  -matrix=<blosum62mt>
       Default: -matrix=blosum62mt

       The usage of this flag has been modified from previous versions,  due
       to frequent mistakes in its usage. This flag  sets  the  matrix  that
       will  be  used  by  alignment  methods  within  t_coffee  (slow_pair,
       lalign_id_pair).  It  does  not   affect   external   methods   (like
       clustal_pair, clustal_aln.).

       Users can also provide their own matrices, using  the  matrix  format
       described in the appendix.

    -nomatch
       Usage:  -nomatch=<positive value>
       Default: -nomatch=0

       Indicates the penalty  to  associate  with  a  match.  When  using  a
       library, all matches are positive or equal to 0. Matches equal  to  0
       are unsupported by the library but non-penalized. Setting nomatch  to
       a non-negative value makes it possible to penalize these null matches
       and prevent unrelated sequences  from  being  aligned  (this  can  be
       useful when the alignments  are  meant  to  be  used  for  structural
       modeling).

    -gapopen
       Usage:  -gapopen=<negative value>
       Default: -gapopen=0

       Indicates the penalty applied for opening a gap. The penalty must  be
       negative. If no value is provided when using a substitution matrix, a
       value will be automatically computed.

       Here are some guidelines regarding the tuning of gapopen and  gapext.
       In T-Coffee matches get a score between 0  (match)  and  1000  (match
       perfectly consistent with the library). The default cosmetic  penalty
       is set to -50 (5% of a perfect match). If you want  to  tune  -gapoen
       and see a strong effect, you should therefore consider values between
       0 and -1000.

    -gapext
       Usage:  -gapext=<negative value>
       Default: -gapext=0

       Indicates the penalty applied for extending a gap (cf -gapopen)

    -fgapopen
       Unsupported

    -fgapext
       Unsupported

    -cosmetic_penalty
       Usage:  -cosmetic_penalty=<negative value>
       Default: -cosmetic_penalty=-50

       Indicates the penalty applied for opening a gap. This penalty is  set
       to a very low value. It will only have an influence on  the  portions
       of the alignment that are unalignable. It will  not  make  them  more
       correct, but only more pleasing to the eye ( i.e. Avoid stretches  of
       lonely residues).

       The cosmetic penalty is automatically turned off  if  a  substitution
       matrix is used rather than a library.

    -tg_mode
       Usage:  -tg_mode=<0, 1, or 2>
       Default: -tg_mode=1

       0: terminal gaps penalized with -gapopen + -gapext*len

       1: terminal gaps penalized with a -gapext*len

       2: terminal gaps unpenalized.



5 Weighting Schemes


    -seq_weight
       Usage: -seq_weight=<t_coffee or <file_name>>
       Default: -seq_weight=t_coffee

       These are the individual  weights  assigned  to  each  sequence.  The
       t_coffee weights try to compensate the bias in consistency caused  by
       redundancy in the sequences.

            sim(A,B)=%similarity between A and B, between 0 and 1.

            weight(A)=1/sum(sim(A,X)^3)

       Weights are normalized  so  that  their  sum  equals  the  number  of
       sequences. They are applied onto the primary library in the following
       manner:

            res_score(Ax,By)=Min(weight(A), weight(B))*res_score(Ax, By)

       These are very simple weights. Their main goal is to prevent a single
       sequence present in many copies to dominate the alignment.

       Note: The library output by -out_lib is the un-weighted  library.


       Note: Weights can be output using the -outseqweight flag.


       Note: You can use your own weights (see the format section).




6 Multiple Alignment Computation


    -msa_mode
       Usage: -msa_mode=<tree,graph,precomputed>
       Default: -evaluate_mode=tree

       Unsupported

    -one2all
       Usage: -one2all=<name>
       Default: not used

       Will generate a one to all library  with  respect  to  the  specified
       sequence and will then align  all  the  sequences  in  turn  to  that
       sequence, in  a  sequence  determined  by  the  order  in  which  the
       sequences were provided.

       -profile_comparison =profile, the  MSAs  provided  via  -profile  are
       vectorized and the function specified by -profile_comparison is  used
       to make profile profile alignments. In that case, the  complexity  is
       NL^2

    -profile_comparison
       Usage: -profile_mode=<fullN,profile>
       Default: -profile_mode=full50

       The profile mode flag controls the multiple profile alignments in  T-
       Coffee. There are two instances  where  t_coffee  can  make  multiple
       profile alignments:

       1-When N, the number  of  sequences  is  higher  than  -maxnseq,  the
       program   switches   to   its   multiple   profile   alignment   mode
       (t_coffee_dpa).

       2-When MSAs are provided via the -profile flag or via  -profile1  and
       -profile2.

       In these situations, the -profile_mode value influences the alignment
       computation, these values are:

       -profile_comparison =profile, the  MSAs  provided  via  -profile  are
       vectorized and the function specified by -profile_comparison is  used
       to make profile profile alignments. In that case, the  complexity  is
       NL^2

       -profile_comparison=fullN, N is an integer value  that  can  omitted.
       Full indicates that given two profiles, the alignment will  be  based
       on a library that includes every possible pair of  sequences  between
       the two profiles. If N is set, then the library will be restricted to
       the N most similar pairs of sequences between the  two  profiles,  as
       judged from a measure made on  a  pairwise  alignment  of  these  two
       profiles.

    -profile_mode
       Usage: -profile_mode=<cw_profile_profile, muscle_profile_profile,
       multi_channel>
       Default: -profile_mode=cw_profile_profile

       When -profile_comparison=profile, this flag selects a profile scoring
       function.

7 Alignment Post-Processing


    -clean_aln
       Usage:  -clean_aln
       Default:-clean_aln

       This flag causes T-Coffee to  post-process  the  multiple  alignment.
       Residues  that  have  a  reliability  score  smaller  or   equal   to
       -clean_threshold   (as   given   by   an   evaluation    that    uses
       -clean_evaluate_mode)  are realigned to the rest  of  the  alignment.
       Residues with a score higher than the threshold  constitute  a  rigid
       framework that cannot be altered.

       The cleaning algorithm is greedy. It starts from the top left segment
       of low constituency residues and works its way left to right, top  to
       bottom along the alignment. You can  require  this  operation  to  be
       carried out for several cycles using the -clean_iterations flag.

       The rationale behind this operation is mostly cosmetic. In  order  to
       ensure a decent looking alignment, the gop is set to -20 and the  gep
       to -1. There is no penalty for  terminal  gaps,  and  the  matrix  is
       blosum62mt.

       Note: Gaps are always considered to have a reliability score of 0.


       Note: The use of the cleaning option can result  in  memory  overflow
       when aligning large sequences,


    -clean_threshold
       Usage:  -clean_threshold=<0-9>
       Default:-clean_aln=1
       See -clean_aln for details.


    -clean_iteration
       Usage:  -clean_iteration=<value between 1 and >
       Default:-clean_iteration=1
       See -clean_aln for details.


    -clean_evaluation_mode
       Usage:  -clean_iteration=<evaluation_mode >
       Default:-clean_iteration=t_coffee_non_extended

       Indicates the mode used for the evaluation  that  will  indicate  the
       segments that should be realigned. See -evaluation_mode for the  list
       of accepted modes.

    -iterate
       Usage: -iterate=<integer>
       Default: -iterate=0

       Sequences are extracted in turn and realigned to the MSA. If  iterate
       is set to -1, each sequence is realigned,  otherwise  the  number  of
       iterations is set by -iterate.

CPU Control


1 Multithreading


    -multi_thread [NOT Supported]
       Usage:  -multi_thread=<N>
       Default: 0

       Specifies that the program should be used in multithreading  mode.  N
       specifies the number of processors available.
         PROMPT: t_coffee sample_seq2.fasta -multi_thread 4

       If you are using a quadriprocessor

2 Limits


    -mem_mode
       Usage:  deprecated

    -ulimit
       Usage:  -ulimit=<value>
       Default: -ulimit=0

       Specifies the upper limit of memory usage (in  Megabytes).  Processes
       exceeding this limit will automatically exit.  A  value  0  indicates
       that no limit applies.

    -maxlen
       Usage:  -maxlen=<value, 0=nolimit>
       Default: -maxlen=1000

       Indicates the maximum length of the sequences.

3 Aligning more than 100 sequences with DPA


    -maxnseq
       Usage:  -maxnseq=<value, 0=nolimit>
       Default: -maxnseq=50

       Indicates the maximum number of sequences before triggering  the  use
       of t_coffee_dpa.

    -dpa_master_aln
       Usage: -dpa_master_aln=<File, method>
       Default: -dpa_master_aln=NO

       When using dpa, t_coffee needs a seed alignment that can be  computed
       using any appropriate method. By default, t_coffee  computes  a  fast
       approximate alignment.

       A pre-alignment can be provided through this flag,  as  well  as  any
       program using the following syntax:

         your_script -in <fasta_file> -out <file_name>


    -dpa_maxnseq
       Usage: -dpa_maxnseq=<integer value>
       Default: -dpa_maxnseq=30

       Maximum number of sequences aligned simultaneously when DPA  is  ran.
       Given the tree computed from the master alignment, a node is sent  to
       computation if it controls more than -dpa_maxnseq OR if it controls a
       pair of sequences having less than -dpa_min_score2 percent ID.

    -dpa_min_score1
       Usage: -dpa_min_score1=<integer value>
       Default: -dpa_min_score1=95

       Threshold  for  not  realigning  the  sequences  within  the   master
       alignment. Given this alignment and the  associated  tree,  sequences
       below a node are  not  realigned  if  none  of  them  has  less  than
       -dpa_min_score1 % identity.

    -dpa_min_score2
       Usage: -dpa_min_score2
       Default: -dpa_min_score2

       Maximum number of sequences aligned simultaneously when DPA  is  ran.
       Given the tree computed from the master alignment, a node is sent  to
       computation if it controls more than -dpa_maxnseq OR if it controls a
       pair of sequences having less than -dpa_min_score2 percent ID.

    -dap_tree [NOT IMPLEMENTED]
       Usage:  -dpa_tree=<filename>
       Default: -unset

       Guide tree used in DPA. This is a  newick  tree  where  the  distance
       associated with each node is set to  the  minimum  pairwise  distance
       among all considered sequences.

Using Structures


1 Generic


    -special_mode
       Usage: -special_mode=3dcoffee
       Default: turned off

       Runs t_coffee with the 3dcoffee mode (cf next section).

    -check_pdb_status
       Usage: -check_pdb_status
       Default: turned off

       Forces t_coffee to run extract_from_pdb to check the  pdb  status  of
       each sequence. This can considerably slow down the program.



2 3D Coffee: Using SAP


       It is  possible  to  use  t_coffee  to  compute  multiple  structural
       alignments. To do so, ensure that you have the sap program installed.
         PROMPT: t_coffee -pdb=struc1.pdb,struc2.pdb,struc3.pdb -method
         sap_pair

       Will combine the pairwise alignments  produced  by  SAP.   There  are
       currently two methods that can be interfaced with t_coffee:

       sap_pair: that uses the sap algorithm

       align_pdb: uses a t_coffee implementation of sap, not as accurate.



       When providing a PDB file, the computation is only carried out on the
       first chain of this file. If  your  original  file  contains  several
       chain, you should extract the chain you want to work on. You can  use
       t_coffee -other_pg extract_from_pdb or any pdb handling program.

       If you are working with  public  PDB  files,  you  can  use  the  PDB
       identifier  and  specify  the  chain  by  adding  its  index  to  the
       identifier (i.e. 1pdbC). If your structure is an NMR  structure,  you
       are advised to provide the program with one structure only.

       If you wish to align only a portion  of  the  structure,  you  should
       extract it yourself from  the  pdb  file,  using  t_coffee  -other_pg
       extract_from_pdb or any pdb handling program.

       You can provide t_coffee with a mixture of sequences  and  structure.
       In this case, you should use the special mode:
         PROMPT: t_coffee -special_mode 3dcoffee -seq 3d_sample3.fasta
         -template_file template_file.template

3 Using/finding PDB templates for the Sequences


    -template_file
       Usage: -template_file =
           <filename,
            SCRIPT_scriptame,
            SELF_TAG
            SEQFILE_TAG_filename,
            no>
       Default: no

       This flag instructs t_coffee on the templates that will be used  when
       combining several types of  information.  For  instance,  when  using
       structural  information,  this  file  will  indicate  the  structural
       template  that  corresponds  to  your  sequences.  The  identifier  T
       indicates that the file should be a FASTA  like  file,  formatted  as
       follows. There are several ways to pass the templates:

       1-File name

       This file contains the sequence/template association it uses a FASTA-
       like format, as follows:

><sequence name> _P_ <pdb template>


><sequence name> _G_ <gene template>


><sequence name> _R_ <MSA template>


><sequence name> _F_ <RNA Secondary Structure>





       Each template will  be  used  in  place  of  the  sequence  with  the
       appropriate  method.  For  instance,  structural  templates  will  be
       aligned with sap_pair and the  information  thus  generated  will  be
       transferred onto the alignment.

       Note the following rule:

            -Each sequence can have one template of each  type  (structural,
       genomics.)

            -Each sequence can only have one template of a given type

            -Several sequences can share the same template

            -All the sequences do not need to have a template

       The type of template on which a method works  is  declared  with  the
       SEQ_TYPE parameter in the method configuration file:

            SEQ_TYPE   S: a method that uses sequences

            SEQ_TYPE   PS: a  pairwise  method  that  aligns  sequences  and
       structures

            SEQ_TYPE   P: a method that aligns structures (sap for instance)

       There are 4 tags identifying the template type:

           _P_   Structural templates: a pdb identifier OR a pdb file

           _G_   Genomic templates: a protein sequence where boundary amino-
                 acid have been recoded with ( o:0, i:1, j:2)

           _R_   Profile Templates: a file containing a  multiple  sequence
       alignment

           _F_   RNA secondary Structures



       More than one template file can be provided. There is no need to have
       one template for every sequence in the dataset.

           _P_, _G_, and _R_ are known as template TAGS

       2-SCRIPT_<scriptname>

       Indicates that filename is a script that will be used to  generate  a
       valid template file. The script will run on  a  file  containing  all
       your sequences using the following syntax:

         scriptname -infile=<your sequences> -outfile=<template_file>


       It is also possible to pass some parameters, use @ as a separator and
       # in place of the = sign. For instance, if you want  to  call  the  a
       script named blast.pl with the foloowing parameters;

         blast.pl -db=pdb -dir=/local/test


       Use

         SCRIPT_blast.pl@db#pdb@dir#/local/test


       Bear in mind that the input output flags will then be concatenated to
       this command line so that t_coffee ends up calling the program  using
       the following system call:

         blast.pl -db=pdb -dir=/local/test -infile=<some tmp file>
         -outfile=<another tmp file>




       3-SELF_TAG

       TAG can take the value of any of the known TAGS (_S_, _G_, _P_). SELF
       indicates that the original name of the  sequence  will  be  used  to
       fetch the template:
         PROMPT: t_coffee 3d_sample2.fasta -template_file SELF_P_

       The previous command will work because the  sequences  in  3d_sample3
       are named

       4-SEQFILE_TAG_filename

       Use this flag if your  templates  are  in  filename,  and  are  named
       according to the sequences. For instance, if your  protein  sequences
       have been recoded with Exon/Intron information, you should  have  the
       recoded sequences names according to the original:

         SEQFILE_G_recodedprotein.fasta


    -struc_to_use
       Usage: -struc_to_use=<struc1, struc2.>
       Default: -struc_to_use=NULL

       Restricts the 3Dcoffee to a set of pre-defined structures.

Multiple Local Alignments

       It is possible to compute multiple local alignments, using  the  moca
       routine. MOCA is a routine  that  allows  extracting  all  the  local
       alignments  that  show  some  similarity  with   another   predefined
       fragment.

       'mocca' is a perl script that calls t-coffee and provides it with the
       appropriate parameters.


    -domain/-mocca
       Usage: -domain
       Default: not set

       This flag indicates that t_coffee will run using the domain mode. All
       the sequences will be concatenated, and the resulting  sequence  will
       be compared to itself using  lalign_rs_s_pair  mode  (lalign  of  the
       sequence against itself using keeping the  lalign  raw  score).  This
       step is the most computer intensive, and it is advisable to save  the
       resulting file.
         PROMPT: t_coffee -in Ssample_seq1.fasta,Mlalign_rs_s_pair
         -out_lib=sample_lib1.mocca_lib -domain -start=100 -len=50

       This instruction will use the fragment 100-150  on  the  concatenated
       sequences, as a template for the extracted  repeats.  The  extraction
       will only be made once. The library will be placed in the  file  <lib
       name>.



       If you want, you can test other coordinates for the repeat, such as
         PROMPT: t_coffee -in sample_lib1.mocca_lib -domain -start=100
         -len=60

       This run will use the fragment  100-160,  and  will  be  much  faster
       because it does not need to re-compute the lalign library.

    -start
       Usage: -start=<int value>
       Default: not set

       This flag indicates the starting position of the portion of  sequence
       that will be used as a template for the repeat extraction. The  value
       assumes that all the sequences have been concatenated, and  is  given
       on the resulting sequence.

    -len
       Usage: -len=<int value>
       Default: not set

       This flag indicates the length of the portion of sequence  that  will
       be used as a template.

    -scale
       Usage: -scale=<int value>
       Default: -scale=-100

       This flag indicates the value of the  threshold  for  extracting  the
       repeats. The actual threshold is equal to:

            motif_len*scale

       Increase the scale (Increase  sensitivity  (  More  alignments(  i.e.
       -50).

    -domain_interactive [Examples]
       Usage: -domain_interactive
       Default: unset

       Launches an interactive mocca session.
         PROMPT: t_coffee -in Lsample_lib3.tc_lib,Mlalign_rs_s_pair -domain
         -start=100 -len=60

TOLB_ECOLI_212_26                      211   SKLAYVTFESGR--SALVIQTLANGAVRQV-
ASFPRHNGAPAFSPDGSKLAFA


TOLB_ECOLI_165_218                                                       164
TRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYV


TOLB_ECOLI_256_306             255           SKLAFALSKTGS--LNLYVMDLASGQIRQV-
TDGRSNNTEPTWFPDSQNLAFT


TOLB_ECOLI_307_350             306           -------DQAGR--PQVYKVNINGGAPQRI-
TWEGSQNQDADVSSDGKFMVMV


TOLB_ECOLI_351_393             350           -------SNGGQ--QHIAKQDLATGGV-QV-
LSSTFLDETPSLAPNGTMVIYS


                        1           *             *     :           .    .:.
:





        MENU: Type Letter Flag[number] and Return: ex |10


        |x      -->Set     the START to x


        >x      -->Set     the LEN   to x


        Cx      -->Set     the sCale to x


        Sname   -->Save    the  Alignment


        Bx      -->Save    Goes back x it


        return  -->Compute the  Alignment


        X       -->eXit





[ITERATION   1] [START=211] [LEN= 50] [SCALE=-100]      YOUR CHOICE:


For instance, to set the length of the domain to 40, type:





[ITERATION     1]   [START=211]    [LEN=    50]    [SCALE=-100]         YOUR
CHOICE:>40[return]


[return]





Which will generate:





TOLB_ECOLI_212_252    211 SKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAF  251


TOLB_ECOLI_256_296    255 SKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTW  295


TOLB_ECOLI_300_340    299 QNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADV  339


TOLB_ECOLI_344_383    343 KFMVMVSSNGGQQHIAKQDLATGGV-QVLSSTFLDETPSL  382


TOLB_ECOLI_387_427    386 TMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAW  426


                        1   :     :     :           ::         .     40














        MENU: Type Letter Flag[number] and Return: ex |10


        |x      -->Set     the START to x


        >x      -->Set     the LEN   to x


        Cx      -->Set     the sCale to x


        Sname   -->Save    the  Alignment


        Bx      -->Save    Goes back x it


        return  -->Compute the  Alignment


        X       -->eXit





[ITERATION   3] [START=211] [LEN= 40] [SCALE=-100]      YOUR CHOICE:




       If you want to indicate  the  coordinates,  relative  to  a  specific
       sequence, type:

            |<seq_name>:start


       Type S<your name> to save the current alignment, and  extract  a  new
       motif.

       Type X when you are done.

Output Control


1 Generic


    Conventions Regarding Filenames
       stdout, stderr, stdin, no, /dev/null are valid filenames. They  cause
       the corresponding file to be output in stderr or stdout, for an input
       file, stdin causes the program to  requests  the  corresponding  file
       through pipe.  No  causes  a  suppression  of  the  output,  as  does
       /dev/null.


    Identifying the Output files automatically
       In the t_coffee output, each output appears in a line:


##### FILENAME <name> TYPE <Type> FORMAT <Format>


    -no_warning
       Usage:  -no_warning
       Default: Switched off

       Suppresseswarning output.

2


3 Alignments


    -outfile
       Usage:  -outfile=<out_aln file,default,no>
       Default:-outfile=default

       Indicates the name of  the  alignment  output  by  t_coffee.  If  the
       default is used, the alignment is named <your sequences>.aln

    -output
       Usage:  -output=<format1,format2,...>
       Default:-output=clustalw

       Indicates the format used for outputting the -outfile.

       Supported formats are:



           clustalw_aln, clustalw : ClustalW format.

           gcg, msf_aln                : MSF alignment.

           pir_aln                : pir alignment.

           fasta_aln        : fasta alignment.

           phylip                 : Phylip format.

           pir_seq                : pir sequences (no gap).

           fasta_seq        : fasta sequences (no gap).



       As well as:



           score_ascii : causes the output of a reliability flag

           score_html  : causes the output to be a reliability plot in HTML

           score_pdf   : idem in  PDF  (if  ps2pdf  is  installed  on  your
           system).

           score_ps         : idem in postscript.



       More than one format can be indicated:
         PROMPT: t_coffee sample_seq1.fasta -output=clustalw,gcg, score_html


       A publication describing the CORE index is available on:
       http://igs-server.cnrs-mrs.fr/~cnotred/Publications/Pdf/core.pp.pdf


    -outseqweight
       Usage:  -outseqweight=<filename>
       Default: not used

       Indicates the name of the file in which the sequences weights  should
       be saved..

    -case
       Usage:  -case=<keep,upper,lower>
       Default: -case=keep
       Instructs the program on the case to  be  used  in  the  output  file
       (Clustalw uses upper case). The default keeps the case and  makes  it
       possible to maintain a mixture of upper and lower case residues.

       If  you  need  to  change  the  case  of  your  file,  you  can   use
       seq_reformat:

         PROMPT: t_coffee -other_pg seq_reformat -in sample_aln1.aln -action
         +lower -output clustalw

    -cpu
       Usage:  deprecated

    -outseqweight
       Usage:  -outseqweight=<name  of  the  file  containing  the   weights
       applied>

       Default: -outseqweight=no

       Will cause the program to output the weights  associated  with  every
       sequence in the dataset.


    -outorder [cw]
       Usage:  -outorder=<input OR aligned OR filename>
       Default:-outorder=input

       Sets  the  order  of  the  sequences   in   the   output   alignment:
       -outorder=input means the sequences are kept in the  original  order.
       -outorder=aligned means the sequences come in the order indicated  by
       the tree. This order can be seen as a one-dimensional  projection  of
       the tree distances. -outdorder=<filename>Filename is  a  legal  fasta
       file, whose order will be used in the final alignment.

    -inorder [cw]
       Usage:  -inorder=<input OR aligned>
       Default:-inorder=aligned

       Multiple alignments based on dynamic programming depend  slightly  on
       the order in which the incoming sequences are  provided.  To  prevent
       this effect sequences are arbitrarily sorted at the beginning of  the
       program (-inorder=aligned). However, this affects the sequence  order
       within  the  library.  You   can   switch   this   off   by   ststing
       -inorder=input.

    -seqnos
       Usage:  -seqnos=<on or off>
       Default:-seqnos=off
       Causes the output alignment to contain residue numbers at the end  of
       each line:


T-COFFEE


seq1 aaa---aaaa--------aa 9


seq2 a-----aa-----------a 4





seq1 a-----------------a 11


seq2 aaaaaaaaaaaaaaaaaaa 19


4 Libraries

       Although, it does not necessarily do so explicitly,  T-Coffee  always
       end up combining libraries. Libraries are  collections  of  pairs  of
       residues. Given a set of libraries,  T-Coffee  makes  an  attempt  to
       assemble the alignment with the highest level of consistence. You can
       think of the alignment as a timetable. Each library pair would  be  a
       request from students or teachers, and the job of T-Coffee  would  be
       to assemble the time table that makes  as  many  people  as  possible
       happy.


    -out_lib
       Usage:  -out_lib=<name of the library,default,no>

       Default:-out_lib=default




       Sets   the   name   of   the   library   output.   Default    implies
       <run_name>.tc_lib

    -lib_only
       Usage:  -lib_only
       Default: unset

       Causes the program to stop once the library has been  computed.  Must
       be used in conjunction with the flag -out_lib

5 Trees


    -newtree
       Usage: -newtree=<tree file>
       Default: No file specified

       Indicates the name of the file into which  the  guide  tree  will  be
       written. The default will be <sequence_name>.dnd, or  <run_name.dnd>.
       The tree is written in the parenthesis format known as newick or  New
       Hampshire and used by Phylips (see the format section).
Do NOT confuse this guide tree with a phylogenetic tree.

Reliability Estimation


1 CORE Computation

       The CORE is an index  that  indicates  the  consistency  between  the
       library of piarwise alignments and the final multiple alignment.  Our
       experiment indicate  that  the  higher  this  consistency,  the  more
       reliable the alignment. A publication describing the CORE  index  can
       be found on:

       http://igs-server.cnrs-mrs.fr/~cnotred/Publications/Pdf/core.pp.pdf


    -evaluate_mode
       Usage:
       -evaluate_mode=<t_coffee_fast,t_coffee_slow,t_coffee_non_extended >
       Default: -evaluate_mode=t_coffee_fast

       This flag indicates the mode used to  normalize  the  t_coffee  score
       when computing the reliability score.

       t_coffee_fast: Normalization is made using the highest score  in  the
       MSA. This evaluation mode was validated and in our  hands,  pairs  of
       residues with a score of  5  or  higher  have  90  %  chances  to  be
       correctly aligned to one another.

       t_coffee_slow: Normalization is made using the library. This  usually
       results in lower score and a scoring scheme  more  sensitive  to  the
       number of sequences in the dataset. Note that this scoring scheme  is
       not any more  slower,  thanks  to  the  implementation  of  a  faster
       heuristic algorithm.

       t_coffee_non_extended: the score of each residue is the ratio between
       the sum of its non extended scores with the column and the sum of all
       its possible non extended scores.

       These modes will be useful when generating  colored  version  of  the
       output, with the -output flag:
         PROMPT: t_coffee sample_seq1.fasta -evaluate_mode t_coffee_slow
         -output score_ascii, score_html
         PROMPT: t_coffee sample_seq1.fasta -evaluate_mode t_coffee_fast
         -output score_ascii, score_html
         PROMPT: t_coffee sample_seq1.fasta -evaluate_mode
         t_coffee_non_extended -output score_ascii, score_html

Generic Output


    -run_name
       Usage: -run_name=<your run name>
       Default: no default set
       This flag causes the prefix <your sequences> to be replaced by  <your
       run name> when renaming the default output files.


    -quiet
       Usage: -quiet=<stderr,stdout,file name OR nothing>.
       Default:-quiet=stderr

       Redirects the standard output to either a file.  -quiet  on  its  own
       redirect the output to /dev/null.

    -align [CW]
       This flag indicates that the program must produce the  alignment.  It
       is here for compatibility with ClustalW.


APDB/iRMSD Parameters



Warning: These flags will only work within the APDB package that can be
invoked via the -other_pg parameter of T-Coffee:
             t_coffee -other_pg apdb -aln <your aln>


    -quiet [Same as T-Coffee]

    -run_name [Same as T-Coffee]

    -aln
       Usage: -aln=<file_name>.
       Default:none

       Indicates the name of the file containing the sequences that need  to
       be evaluated. The sequences whose structure is meant to be used  must
       be named according to their PDB identifier.

       The format can be FASTA, CLUSTAL or any of the formats supported by T-
       Coffee. APDB only evaluates residues in capital and ignores those  in
       lower case. If your sequences are in lower case, you can  upper  case
       them using seq_reformat:
         PROMPT: t_coffee -other_pg seq_reformat -in 3d_sample4.aln -action
         +upper -output clustalw > 3d_sample4.cw_aln

       The alignment can then be evaluated using the defaultr of APDB:
         PROMPT: t_coffee -other_pg apdb -aln 3d_sample4.aln

       The alignment can contain as many structures as you wish.

    -n_excluded_nb
       Usage: -n_excluded_nb=<integer>.
       Default:1

       When evaluating the local score of a pair of  aligned  residues,  the
       residues immediately next to that column should not contribute to the
       measure. By default the first to the left and first to the right  are
       excluded.

    -maximum_distance
       Usage: -maximum_distance=<float>.
       Default:10

       Size of the neighborhood  considered  around  every  residue.  If  .-
       local_mode is set to sphere, -maximum_distance is  the  radius  of  a
       sphere centered around each residue. If -local_mode is set to window,
       then  -maximum_distance  is  the  size  of  the  half  window   (i.e.
       window_size=-maximum_distance*2+1).

    -similarity_threshold
       Usage: -similarity_threshold=<integer>.
       Default:70

       Fraction of the neighborhood that must be supportive for  a  pair  of
       residue to be considered correct  in  APDB.  The  neighborhood  is  a
       sphere defined by -maximum_distance, and the support  is  defined  by
       -md_threshold.

    -local_mode
       Usage: -local_mode=<sphere,window>.
       Default:sphere

       Defines the shape of a neighborhood, either  as  a  sphere  or  as  a
       window.

    -filter
       Usage: -filter=<0.00-1.00>.
       Default:1.00

       Defines the centiles that  should  be  kept  when  making  the  local
       measure. Foir instance, -filter=0.90  means  that  the  the  10  last
       centiles will be removed  from  the  evaluation.  The  filtration  is
       carried out on the iRMSD values.

    -print_rapdb [Unsupported]
       Usage: -print_rapdb (FLAG)
       Default:off

       This causes the  prints  out  of  the  exact  neighborhood  of  every
       considered pair of residues.

    -outfile [Same as T-Coffee]
       This flag is meant to control the output name  of  the  colored  APDB
       output. This file will either display the local  APDB  score  or  the
       local iRMD, depending on the value of -color_mode. The default format
       is defined by -ouptut and is score_html.


    -color_mode
       Usage: -color_mode=<apdb, irmsd>
       Default:apdb
       This flag is meant to control the colored APDB output (local  score).
       This file will either display the local APDB score or the local iRMD.


                              Building a Server

       We maintain a T-Coffee server (www.tcoffee.org). We will  be  pleased
       to provide anyone who wants to set up  a  similar  service  with  the
       sources


1 Environment Variables

       T-Coffee stores a lots  of  information  in  locations  that  may  be
       unsuitable when running a server.

       By default, T-Coffee will generate and rely on the follwing directory
       structure:


      /home/youraccount/          #HOME_4_TCOFFEE


      HOME_4_TCOFFEE/.t_coffee/   #DIR_4_TCOFFEE


      DIR_4_TCOFFEE/cache         #CACHE_4_TCOFFEE


      DIR_4_TCOFFEE/tmp           #TMP_4_TCOFFEE


      DIR_4_TCOFFEE/methods       #METHOS_4_TCOFFEE


      DIR_4_TCOFFEE/mcoffee       #MCOFFEE_4_TCOFFEE



       By  default,  all  these  directories  are   automatically   created,
       following the dependencies suggested here.

       The first step is the determination  of  the  HOME.  By  default  the
       program tries to use HOME_4_TCOFFEE, then the HOME variable  and  TMP
       or TEMP if HOME is not set on your system or your account. It is your
       responsibility to make sure that one of these  variables  is  set  to
       some valid location where the T-Coffee process is allowed to read and
       write.

       If no valid location can be found  for  HOME_4_TCOFFEE,  the  program
       exits. If you are running T-Coffee on a server, we recommend to  hard
       set the following locations, where your scratch is a valid location.




      HOME_4_TCOFFEE="your scratch"


      TMP_4_TCOFFEE="your scratch"


      DIR_4_TCOFFEE="your scratch"


      CACHE_4_TCOFFEE="your scratch"


      NO_ERROR_REPORT_4_TCOFFEE=1

       Note that  it is a good idea to have a cron job that cleans  up  this
       scratch area, once in a while.




2 Output of the .dnd file.

       A common source of error when running a server: T-Coffee MUST  output
       the .dnd file because it re-reads it to  carry  out  the  progressive
       alignment. By default T-Coffee outputs this  file  in  the  directory
       where the process is running. If the T-Coffee process does  not  have
       permission to write in that directory, the computation will abort...

       To avoid this, simply specify the name of the output tree:

            -newtree=<writable file (usually in /tmp)>

       Chose the name so that two processes may not  over-write  each  other
       dnd file.


3 Permissions

       The t_coffee process MUST be allowed to write in some  scratch  area,
       even when it is ran by Mr nobody... Make sure the /tmp/ partition  is
       not protected.


4 Other Programs

       T-Coffee may call various programs  while  it  runs  (lalign2list  by
       defaults).  Make  sure  your  process  knows  where  to  find   these
       executables.


                                   Formats


Parameter files

       Parameter   files   used   with   -parameters,    -t_coffee_defaults,
       -dali_defaults... Must contain a valid parameter  string  where  line
       breaks are allowed. These  files  cannot  contain  any  comment,  the
       recommended format is one parameter per line:


      <parameter name>=<value1>,<value2>....


      <parameter name>=.....


Sequence Name Handling

       Sequence name handling is meant to be fully consistent with  ClustalW
       (Version 1.75). This implies that in some cases  the  names  of  your
       sequences may be edited when coming out of the  program.  Five  rules
       apply:



                     Naming Your Sequences the Right Way
1-No Space
Names that do contain spaces, for instance:
      >seq1 human_myc
will be turned into
      >seq1
It is your responsibility to make sure that the names you provide are not
ambiguous after such an editing. This editing is consistent with Clustalw
(Version 1.75)

2-No Strange Character
Some non alphabetical characters are replaced with underscores. These are:
';:()'
Other characters are legal and will be kept unchanged. This editing is
meant to keep in line with Clustalw (Version 1.75).

3-> is NEVER legal (except as a header token in a FASTA file)

4-Name length must be below 100 characters, although 15 is recommended for
compatibility with other programs.
5-Duplicated sequences will be renamed (i.e. sequences with the same name
in the same dataset) are allowed but will be renamed according to their
original order. When sequences come from multiple sources via the -in flag,
consistency of the renaming is not guaranteed. You should avoid duplicated
sequences as they will cause your input to differ from your output thus
making it difficult to track data.

Automatic Format Recognition

       Most common formats are automatically recognized by t_coffee. See -in
       and the next  section  for  more  details.  If  your  format  is  not
       recognized, use readseq or clustalw to switch to another  format.  We
       recommend Fasta.


Structures

       PDB format is recognized by T-Coffee. T-Coffee uses  extract_from_pdb
       (cf -other_pg flag). extract_from_pdb is a small embeded module  that
       can be used on its own to extract information from pdb files.


RNA Structures

       RNA structures are expressed as T-Coffee libraries,  with  each  line
       indicating two paired residues.


Sequences

       Sequences can come in the following formats: fasta, pir,  swiss-prot,
       clustal aln, msf aln and t_coffee aln.  These  formats  are  the  one
       automatically recognized. Please replace the '*' sign sometimes  used
       for stop codons with an X.


Alignments

       Alignments can come in the following formats: msf,  ClustalW,  Fasta,
       Pir and t_coffee. The t_coffee format is very similar to the ClustalW
       format, but slightly  more  flexible.  Any  interleaved  format  with
       sequence name on each line will be correctly parsed:


<empy line>      [Facultative]n


<line of text>   [Required]


<line of text>              [Facultative]n


<empty line>                [Required]


<empty line>                [Facultative]n


<seq1 name><space><seq1>


<seq2 name><space><seq2>


<seq3 name><space><seq3>


<empty line>                [Required]


<empty line>                [Facultative]n


<seq1 name><space><seq1>


<seq2 name><space><seq2>


<seq3 name><space><seq3>


<empty line>                [Required]


<empty line>                [Facultative]n

       An empty line is a line that does NOT contain amino-acid. A line that
       contains the ClustalW annotation (.:*) is empty.

       Spaces are forbidden in the name. When the alignment is  being  read,
       non character signs are  ignored  in  the  sequence  field  (such  as
       numbers, annotation.).


       Note: a different number of lines in the different blocks will  cause
       the program to crash or hang.


Libraries


1 T-COFFEE_LIB_FORMAT_01

       This is currently the only supported format.


!<space> TC_LIB_FORMAT_01


<nseq>


<seq1 name> <seq1 length> <seq1>


<seq2 name> <seq2 length> <seq2>


<seq3 name> <seq3 length> <seq3>


!Comment


(!Comment)n


#Si1 Si2


Ri1 Ri2 V1 (V2, V3)


#1 2


12 13 99 (12/0 vs 13/1, weight 99)


12 14 70


15 16 56


#1 3


12 13 99


12 14 70


15 16 56


!<space>SEQ_1_TO_N

       Si1: index of Sequence 1

       Ri1: index of residue 1 in seq1

       V1: Integer Value: Weight

       V2, V3: optional values


       Note 1: There is a space between the ! And SEQ_1_TO_N


       Note 2: The last line (! SEQ_1_TO_N) indicates that:

       Sequences and residues are numbered from 1 to  N,  unless  the  token
       SEQ_1_TO_N is omitted, in which case the sequences are numbered  from
       0 to N-1, and residues are from 1 to N.

       Residues do not need to be sorted, and neither do the sequences.  The
       same pair can appear several times in the library. For instance,  the
       following file would be legal:


#1 2


12 13 99


#1 2


15 16 99


#1 1


12 14 70

       It is also poosible to declare ranges of resdues rather  than  single
       pairs. For instance, the following:


#0 1


+BLOCK+  10 12 14 99


+BLOCK+  15 30 40 99


#0 2


15 16 99


#0 1


12 14 70

       The first statement BLOCK declares a BLOCK of length 10, that  starts
       on position 12 of sequence 1 and position 14 of sequence 2 and  where
       each pair of residues within the block has a score of 99. The  second
       BLOCK starts on residue 30 of 1, residue 40 of 2 and extends  for  15
       residues.

       Blocks can overalp and be incompatible with one  another,  just  like
       single constraints.




2 T-COFFEE_LIB_FORMAT_02

       A simpler format is being developed, however  it  is  not  yet  fully
       supported and is only mentioned here for development purpose.


! TC_LIB_FORMAT_02


#S1 SEQ1 [OPTIONAL]


#S2 SEQ2 [OPTIONAL]


...


!comment [OPTIONAL]


S1 R1 Ri1 S2 R2 Ri2 V1 (V2 V3)


=> N R1 Ri1 S2 R2 Ri2 V1 (V2 V3)


...

       S1, S2: name of sequence 1 and 2

       SEQ1: sequence of S1

       Ri1, Ri2: index of the residues in their respective sequence

       R1, R2: Residue type

       V1, V2, V3: integer Values (V2 and V3 are optional)

       Value1, Value 2 and Value3 are optional.


Library List

       These are lists of pairs of sequences that must be used to compute  a
       library. The format is:


<nseq> <S1> <S2>


2 hamg2 globav


3 hamgw hemog singa


...


Substitution matrices.

       If the required substitution matrix is not available, write your  own
       in a file using the following format:


1 ClustalW Style [Deprecated]


# CLUSTALW_MATRIX FORMAT


$


v1


v2 v3


v4 v5 v6


...


$

       v1, v2... are integers, possibly negatives.

       The order of the amino acids is: ABCDEFGHIKLMNQRSTVWXYZ, which  means
       that v1 is the substitution value for A vs A, v2 for A vs B, v3 for B
       vs B, v4 for A vs C and so on.


2 BLAST Format [Recommended]


# BLAST_MATRIX FORMAT


# ALPHABET=AGCT


 A G C T


A 0 1 2 3


G 0 2 3 4


C 1 1 2 3


...

       The alphabet can be freely defined


Sequences Weights

       Create your own weight file, using the -seq_weight flag:


# SINGLE_SEQ_WEIGHT_FORMAT_01


seq_name1 v1


seq_name2 v2


...

       No duplicate allowed. Sequences not included in the set of  sequences
       provided to t_coffee will be ignored. Order is free. V1 is  a  float.
       Un-weighted sequences will see their weight set to 1.


                               Known Problems

       1-Sensitivity to sequence order: It is difficult to implement  a  MSA
       algorithm totally insensitive to the order of input of the sequences.
       In  t_coffee,  robustness  is  increased  by  sorting  the  sequences
       alphabetically before aligning them. Beware that this can  result  in
       confusing output where sequences with similar name  are  unexpectedly
       close to one another in the final alignment.

       2-Nucleotides sequences with long stretches of Ns will cause problems
       to lalign, especially when using Mocca. To avoid any problem,  filter
       out these nucleotides before running mocca.

       3-Stop codons are sometimes coded with '*' in protein sequences. This
       will cause the program to crash or hang. Please replace the '*' signs
       with an X.

       4-Results can differ from one architecture to another,  due  rounding
       differences. This is caused by the tree estimation procedcure. If you
       want to make sure an alignment is reproducible, you should  keep  the
       associated dendrogram.


                               Technical Notes

       These notes are only meant for internal development.


Development

       The following examples are only meant for internal  development,  and
       are used to insure stability from release to release


    profile2list

       prf1: profile containing one structure

       prf2: profile containing one structure



         PROMPT: t_coffee  Rsample_profile1.aln,Rsample_profile2.aln
         -special_mode=3dcoffee -outfile=aligned_prf.aln


2 Command Line List

       These command lines have been checked  before  every  release  (along
       with the other CL in this documentation:



       -external methods;

            PROMPT: t_coffee sample_seq1.fasta
         -in=Mclustalw_pair,Mclustalw_msa,Mslow_pair -outfile=clustal_text
       -fugue_client

         PROMPT: t_coffee -in Ssample_seq5.fasta Pstruc4.pdb Mfugue_pair
       -A list of command lines kindly provided by  James  Watson  (used  to
       crash the pg before version 3.40)

         PROMPT: t_coffee -in Sseq.fas P2PTC Mfugue_pair
         PROMPT: t_coffee -in S2seqs.fas Mfugue_pair -template_file SELF_P_
         PROMPT: t_coffee -special_mode 3dcoffee -in Sseq.fas P2PTC
         PROMPT: t_coffee -special_mode 3dcoffee -in S2seqs.fas
         -template_file SELF_P_
       -A list of command lines that crashed the program before 3.81

         PROMPT: t_coffee sample_seq6.fasta -in Mfast_pair Msap_pair
         Mfugue_pair -template_file template_file6.template
      -A command line to read "relaxed" pdb files...

         PROMPT: t_coffee -in Msap_pair Ssample_seq7.fasta -template_file
         template_file7.template -weight 1001 -out_lib test_lib7.tc_lib
         -lib_only
      -Parsing of MARNA libraries

         PROMPT: t_coffee -in Lmarna.tc_lib -outfile maran.test
      -Parsing of long sequence lines:

         PROMPT: t_coffee -in Asample_aln5.aln -outfile test.aln



                                   To Do.

       -implement UPGMA tree computation

       -implement seq2dpa_tree

       -debug dpa

       -Reconciliate sequences and template when reading the template

       -Add the server command lines to the checking procedure








